(data stored in ACNUC7421 zone)

EMBL: CP002157.PE127

CP002157.PE127       Location/Qualifiers
FT   CDS             complement(147209..148558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16766"
FT                   /product="putative potassium uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16766"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00756"
FT                   /db_xref="GOA:A4ATI6"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATI6"
FT                   /protein_id="EAR00756.1"
FT                   /translation="MKIIIAGAGEVGFHLAKLLSYESQDITLIDTDKESLMYADNHLDI
FT                   RVLRGDATSISILEDAQVKDCSLVIGVTSSQTTNITFCMLAKQLGCKRTIARISNTEFI
FT                   EHKERIRFSELGIDELISPEELAAEEIRMLLNKSAFNDTYEFEDGKLIMVGVSLQKSAP
FT                   FVGKMVKEAAMIFPELHFMPIALQRTGTQFTVIPRGDTVFKEGDQVYFIITPEGVDELY
FT                   KLTDKKKEDIKNVMILGGSKVGFKSARDLCTKKFNVKLIEKNKEKAFDLADELPNALVI
FT                   NGDGRNVELLEEESLDSMDAFIAVTGNSETNIMSCLVAKSKHIKKTIALVENMDYFQLS
FT                   HSIGIDTLINKKLLAANNIFKYIRKGEVVALMRLNNINAEILEFVVKPKSKVTGSIIRE
FT                   LDIPKTATIGGVVRNGKGIIALGGFEIKAGDRVVVCCLPNAIPIIEKLFL"
     MKIIIAGAGE VGFHLAKLLS YESQDITLID TDKESLMYAD NHLDIRVLRG DATSISILED        60
     AQVKDCSLVI GVTSSQTTNI TFCMLAKQLG CKRTIARISN TEFIEHKERI RFSELGIDEL       120
     ISPEELAAEE IRMLLNKSAF NDTYEFEDGK LIMVGVSLQK SAPFVGKMVK EAAMIFPELH       180
     FMPIALQRTG TQFTVIPRGD TVFKEGDQVY FIITPEGVDE LYKLTDKKKE DIKNVMILGG       240
     SKVGFKSARD LCTKKFNVKL IEKNKEKAFD LADELPNALV INGDGRNVEL LEEESLDSMD       300
     AFIAVTGNSE TNIMSCLVAK SKHIKKTIAL VENMDYFQLS HSIGIDTLIN KKLLAANNIF       360
     KYIRKGEVVA LMRLNNINAE ILEFVVKPKS KVTGSIIREL DIPKTATIGG VVRNGKGIIA       420
     LGGFEIKAGD RVVVCCLPNA IPIIEKLFL                                         449
//

If you have problems or comments...

PBIL Back to PBIL home page