(data stored in ACNUC7421 zone)

EMBL: CP002157.PE129

CP002157.PE129       Location/Qualifiers
FT   CDS             149545..150240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16776"
FT                   /product="porT protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16776"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00758"
FT                   /db_xref="InterPro:IPR025665"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATI8"
FT                   /protein_id="EAR00758.1"
FT                   /translation="MKHYLLILIGLVFLSQPVMAQFNEKPVLNKENEDKAFLNWGYFLG
FT                   FNQYDFKFDYKNDTKDILVNKSLGFNVGLIGEMRINEFLDARLEPGLLYNSRELGFPGF
FT                   LEEKDAIREVKSTYINFPVLLKVSTRRFANWKPFLIGGASTSLNLGSNETSLDDNSGGT
FT                   FRMKKWVYNYELGFGIDFYLQYFKFTPSIRGVFAISDELVPDNDPNSPWTGNIAAMRTR
FT                   GLFVNFTFE"
     MKHYLLILIG LVFLSQPVMA QFNEKPVLNK ENEDKAFLNW GYFLGFNQYD FKFDYKNDTK        60
     DILVNKSLGF NVGLIGEMRI NEFLDARLEP GLLYNSRELG FPGFLEEKDA IREVKSTYIN       120
     FPVLLKVSTR RFANWKPFLI GGASTSLNLG SNETSLDDNS GGTFRMKKWV YNYELGFGID       180
     FYLQYFKFTP SIRGVFAISD ELVPDNDPNS PWTGNIAAMR TRGLFVNFTF E                231
//

If you have problems or comments...

PBIL Back to PBIL home page