(data stored in ACNUC7421 zone)

EMBL: CP002157.PE131

CP002157.PE131       Location/Qualifiers
FT   CDS             150953..153616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16786"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16786"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00760"
FT                   /db_xref="GOA:A4ATJ0"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATJ0"
FT                   /protein_id="EAR00760.1"
FT                   /translation="MAFTNHANNVFLISMRIVFRFKNPYAKISLLFFAITLVSCNALKK
FT                   VDDGELLLTGNTIYADEEKVNDEDIQSLIIQEPNSTLLGYPLRLNLYNLAKQNPDSLFQ
FT                   DWLYRKEKRRKRLANILSEKQVDRLGESFLVKGMSEWLKNIGEPPAIIDTLDTQRTLER
FT                   LKAYYNSKGYFNNNTTYAIDSLKRPKRAAIDYKITLGEPYVIDSISDIISSKVIDSIYQ
FT                   LNKKQSLIKKGKQFDFLDFDNERKRLTALFRNSGIRNFQESSVNFAITRDSTKSGTNKK
FT                   TDIAINIDNLRTRNDNTISSSEYKVERFKQINIYTDFILSGDEEQNNVVKYGNYNIYYK
FT                   DKLRFKPKTLTDAIFFEKDSIYRESDRSSTYRRITSLNVFKYPSIAFDTDSLSGLSANI
FT                   YLTERPKYSLGMELDVSHSNIQQVGMAFSPSLQVRNLFKGAENFSLTGRMNIGSSKDES
FT                   IRASDSHFFNLLEFGADVNLTFPRIWFPFIKTDKIIPNYTLPQTRLSLGASSQKNIGLD
FT                   KWTFNTVLGYNWTPSDFKKHNVELLNIQFVDNLKPYRFFNVYQNSYDRLNEIANKYDEA
FT                   NEFDDPNDYETFSGFYEPSDDPNDPDLSIPSGTDGFIDEITDNTVPVSTDDLNEVRSIE
FT                   ERRDRLTENNLIFATNYSFSKHNQNGITDNSFHRFRFKVESAGNLLSALSYVIPFNEKD
FT                   GDLLVFDVPYSQYIKTEFDYIKYWDLSRSNVLAFRSFFGIAIPYGNSDNIPFVRSYFAG
FT                   GSNDNRAWNPYSLGPGKTNEINDFNEANLKLAFNLEYRFPVVGDIKGALFADAGNIWNV
FT                   FDNEDDPDKTFNGIDSLTDIALGTGFGVRYDFTYFLIRVDLGFKTYNPAEEISKRWFRD
FT                   YNFANSVLQIGINYPF"
     MAFTNHANNV FLISMRIVFR FKNPYAKISL LFFAITLVSC NALKKVDDGE LLLTGNTIYA        60
     DEEKVNDEDI QSLIIQEPNS TLLGYPLRLN LYNLAKQNPD SLFQDWLYRK EKRRKRLANI       120
     LSEKQVDRLG ESFLVKGMSE WLKNIGEPPA IIDTLDTQRT LERLKAYYNS KGYFNNNTTY       180
     AIDSLKRPKR AAIDYKITLG EPYVIDSISD IISSKVIDSI YQLNKKQSLI KKGKQFDFLD       240
     FDNERKRLTA LFRNSGIRNF QESSVNFAIT RDSTKSGTNK KTDIAINIDN LRTRNDNTIS       300
     SSEYKVERFK QINIYTDFIL SGDEEQNNVV KYGNYNIYYK DKLRFKPKTL TDAIFFEKDS       360
     IYRESDRSST YRRITSLNVF KYPSIAFDTD SLSGLSANIY LTERPKYSLG MELDVSHSNI       420
     QQVGMAFSPS LQVRNLFKGA ENFSLTGRMN IGSSKDESIR ASDSHFFNLL EFGADVNLTF       480
     PRIWFPFIKT DKIIPNYTLP QTRLSLGASS QKNIGLDKWT FNTVLGYNWT PSDFKKHNVE       540
     LLNIQFVDNL KPYRFFNVYQ NSYDRLNEIA NKYDEANEFD DPNDYETFSG FYEPSDDPND       600
     PDLSIPSGTD GFIDEITDNT VPVSTDDLNE VRSIEERRDR LTENNLIFAT NYSFSKHNQN       660
     GITDNSFHRF RFKVESAGNL LSALSYVIPF NEKDGDLLVF DVPYSQYIKT EFDYIKYWDL       720
     SRSNVLAFRS FFGIAIPYGN SDNIPFVRSY FAGGSNDNRA WNPYSLGPGK TNEINDFNEA       780
     NLKLAFNLEY RFPVVGDIKG ALFADAGNIW NVFDNEDDPD KTFNGIDSLT DIALGTGFGV       840
     RYDFTYFLIR VDLGFKTYNP AEEISKRWFR DYNFANSVLQ IGINYPF                     887
//

If you have problems or comments...

PBIL Back to PBIL home page