(data stored in ACNUC7421 zone)

EMBL: CP002157.PE134

CP002157.PE134       Location/Qualifiers
FT   CDS             complement(155679..156539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16801"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16801"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00763"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATJ3"
FT                   /protein_id="EAR00763.1"
FT                   /translation="MKKNLRKVKFMGSLLLAICVLGSCDKDDSQNISEDMTITATELNA
FT                   SDEADLIIEDVVNIGEEVYATDEIMTTSKADYRSDYLPDCVTITTVLTSTSKEKSIDFG
FT                   EGCELPNGNILSGIIQLSYLKDMDLATKTLSMSLENFTFNGVAVDGNASIVRMRNNENG
FT                   NPESNAEADFEGNWPDGDSASFSANRTREWIEGYGSGYWGDNAFLISGKATYTGKLGNV
FT                   FMKETIVPLRRELSCRFIVSGILEISRNDATASLDFGDGSCDAKGILTHPDGESEEIFL
FT                   RRFKH"
     MKKNLRKVKF MGSLLLAICV LGSCDKDDSQ NISEDMTITA TELNASDEAD LIIEDVVNIG        60
     EEVYATDEIM TTSKADYRSD YLPDCVTITT VLTSTSKEKS IDFGEGCELP NGNILSGIIQ       120
     LSYLKDMDLA TKTLSMSLEN FTFNGVAVDG NASIVRMRNN ENGNPESNAE ADFEGNWPDG       180
     DSASFSANRT REWIEGYGSG YWGDNAFLIS GKATYTGKLG NVFMKETIVP LRRELSCRFI       240
     VSGILEISRN DATASLDFGD GSCDAKGILT HPDGESEEIF LRRFKH                      286
//

If you have problems or comments...

PBIL Back to PBIL home page