(data stored in ACNUC7421 zone)

EMBL: CP002157.PE14

CP002157.PE14        Location/Qualifiers
FT   CDS             complement(30889..31326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16201"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16201"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00643"
FT                   /db_xref="GOA:A4AT73"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT73"
FT                   /protein_id="EAR00643.1"
FT                   /translation="MAKEVGKVVKLQVRGGAANPSPPVGPALGAAGVNIMEFCKQFNAR
FT                   TQDKPGKVLPVVITVYKDKSFDFIVKTPPAAVQLLEAAKIKKGSGEPNRVKLGSVTWDQ
FT                   IKAIAEDKMVDLNAFTVESAMSMVAGTARSMGMKVAGKRPF"
     MAKEVGKVVK LQVRGGAANP SPPVGPALGA AGVNIMEFCK QFNARTQDKP GKVLPVVITV        60
     YKDKSFDFIV KTPPAAVQLL EAAKIKKGSG EPNRVKLGSV TWDQIKAIAE DKMVDLNAFT       120
     VESAMSMVAG TARSMGMKVA GKRPF                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page