(data stored in ACNUC7421 zone)

EMBL: CP002157.PE142

CP002157.PE142       Location/Qualifiers
FT   CDS             165034..165966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16841"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16841"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00771"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATK1"
FT                   /protein_id="EAR00771.1"
FT                   /translation="MINLKNAVFIFLLVIVGCKETKKEVLVEKTPQKFITPLAKEIIIP
FT                   EPWGQMSELFEKAKKDFENDPDNLENIIWYGRRAAYIGQYEKAIDIYSDGIEKYPSESR
FT                   LYRHRGHRLISLRKYNMAINDLKKASELIEDKENEMEADGIPNALNTPVSSKHGNIWYH
FT                   LGLAYYLIHDYENAYAAYLKCRQSGNNADNIVSSTHWLYMIQQRMGNPDKAKEMLEPIS
FT                   ADANIIENQGYHDLCKFYKGIIPIDSLMNTEKGNPSSDAVFYGLANWHFYNNDKPKAHK
FT                   MMLEMMESKAWSSFGYLAAESDIIEYFND"
     MINLKNAVFI FLLVIVGCKE TKKEVLVEKT PQKFITPLAK EIIIPEPWGQ MSELFEKAKK        60
     DFENDPDNLE NIIWYGRRAA YIGQYEKAID IYSDGIEKYP SESRLYRHRG HRLISLRKYN       120
     MAINDLKKAS ELIEDKENEM EADGIPNALN TPVSSKHGNI WYHLGLAYYL IHDYENAYAA       180
     YLKCRQSGNN ADNIVSSTHW LYMIQQRMGN PDKAKEMLEP ISADANIIEN QGYHDLCKFY       240
     KGIIPIDSLM NTEKGNPSSD AVFYGLANWH FYNNDKPKAH KMMLEMMESK AWSSFGYLAA       300
     ESDIIEYFND                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page