(data stored in ACNUC7421 zone)

EMBL: CP002157.PE15

CP002157.PE15        Location/Qualifiers
FT   CDS             complement(31394..31945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16206"
FT                   /product="putative transcription antitermination protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16206"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00644"
FT                   /db_xref="GOA:A4AT74"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT74"
FT                   /protein_id="EAR00644.1"
FT                   /translation="MSEVLEKKWYVVRAVSGQENKIKGYIESEVTRLGFSDYLEDVLVP
FT                   TEKVIQIRNGKKINKERVYFPGYIMIKANLGGEMIHIIRSITNVIGFLGETKGGDPVPL
FT                   RKTEVNRMLGKVDELAVNTDSIAIPFVHGETVKVIDGPFNGFNGTVEKINEEKRKLEVM
FT                   VKIFGRKTPLELSYMQVEKV"
     MSEVLEKKWY VVRAVSGQEN KIKGYIESEV TRLGFSDYLE DVLVPTEKVI QIRNGKKINK        60
     ERVYFPGYIM IKANLGGEMI HIIRSITNVI GFLGETKGGD PVPLRKTEVN RMLGKVDELA       120
     VNTDSIAIPF VHGETVKVID GPFNGFNGTV EKINEEKRKL EVMVKIFGRK TPLELSYMQV       180
     EKV                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page