(data stored in ACNUC7421 zone)

EMBL: CP002157.PE150

CP002157.PE150       Location/Qualifiers
FT   CDS             complement(174464..175684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16881"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16881"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00779"
FT                   /db_xref="InterPro:IPR008322"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATK9"
FT                   /protein_id="EAR00779.1"
FT                   /translation="MPSTKTVLIIGCFDTKGEDFDFLYNCLLEQNIEVISINTGVLGTT
FT                   KLFPVTIDSVTIAEAAGTSLFNLIEDGDRGRALEKMGEGASIIISELMTKKKIDGFIGM
FT                   GGGGGTYVFLSAVNKIPFGIPKLCLTTLATKDLSEHIGSKDITLIPSIVDVAGLNKISR
FT                   ILINQAAGALVGMMNVIDKSQSQTRGSIAISIFGNTTPCVDRCSKILRKKEFDVLSFHA
FT                   VGAGGKTMEDLVLDDCFDAVLDITTTELADDLCGGICSAGPERLTAAGKMGIPQVVVPG
FT                   CLDMVNFGALKTVPRHYQQRQLFSWDPNVTLMRTNKAENKILGTSFAQKLNDSQGKVVV
FT                   LLPMKGISKISREGEVFYAPDVDNVLFDSIKQNLSPEIPIIEVDTDINHAKFADIAVME
FT                   LLKLIQD"
     MPSTKTVLII GCFDTKGEDF DFLYNCLLEQ NIEVISINTG VLGTTKLFPV TIDSVTIAEA        60
     AGTSLFNLIE DGDRGRALEK MGEGASIIIS ELMTKKKIDG FIGMGGGGGT YVFLSAVNKI       120
     PFGIPKLCLT TLATKDLSEH IGSKDITLIP SIVDVAGLNK ISRILINQAA GALVGMMNVI       180
     DKSQSQTRGS IAISIFGNTT PCVDRCSKIL RKKEFDVLSF HAVGAGGKTM EDLVLDDCFD       240
     AVLDITTTEL ADDLCGGICS AGPERLTAAG KMGIPQVVVP GCLDMVNFGA LKTVPRHYQQ       300
     RQLFSWDPNV TLMRTNKAEN KILGTSFAQK LNDSQGKVVV LLPMKGISKI SREGEVFYAP       360
     DVDNVLFDSI KQNLSPEIPI IEVDTDINHA KFADIAVMEL LKLIQD                      406
//

If you have problems or comments...

PBIL Back to PBIL home page