(data stored in ACNUC7421 zone)

EMBL: CP002157.PE151

CP002157.PE151       Location/Qualifiers
FT   CDS             176062..176820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16886"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16886"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00780"
FT                   /db_xref="GOA:A4ATL0"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATL0"
FT                   /protein_id="EAR00780.1"
FT                   /translation="MSEQLKKMTEHQCSNTPAKYDDLKVLFLNCTLNRSPVLSHTEGLI
FT                   HIAQRIFEANGASTKIIRPVDYEIPAGLGLDMSKTPEWDKDDWPLIQKKIDTCDILIVC
FT                   TSVWLGEKSSVCNRTLERMYGYTHQFNEKGQYRDYGKVGATLITGNEDGVKHCAMNILF
FT                   SLSHIGYTVPPQADAGWMGEAGPGPSYRDEGSGGPENDFTNRNTTFLVWNCLHLARMLK
FT                   DQGGIPAHGNQPDEWQAGCKAGFDSPEHQR"
     MSEQLKKMTE HQCSNTPAKY DDLKVLFLNC TLNRSPVLSH TEGLIHIAQR IFEANGASTK        60
     IIRPVDYEIP AGLGLDMSKT PEWDKDDWPL IQKKIDTCDI LIVCTSVWLG EKSSVCNRTL       120
     ERMYGYTHQF NEKGQYRDYG KVGATLITGN EDGVKHCAMN ILFSLSHIGY TVPPQADAGW       180
     MGEAGPGPSY RDEGSGGPEN DFTNRNTTFL VWNCLHLARM LKDQGGIPAH GNQPDEWQAG       240
     CKAGFDSPEH QR                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page