(data stored in ACNUC7421 zone)

EMBL: CP002157.PE152

CP002157.PE152       Location/Qualifiers
FT   CDS             complement(176862..177947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16891"
FT                   /product="Alpha-tubulin suppressor and related RCC1
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16891"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00781"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATL1"
FT                   /protein_id="EAR00781.1"
FT                   /translation="MIPTYPKRAVTTVQTFFLVFFLIISSCSKDNVVDILDSEENGENE
FT                   NPIAPDDSQLENNFVLDESNRVVNYILPKIEYDKYLEDEGDFSLISKKIYEHFNDDFDF
FT                   IFVLSNEEEVPQDLYYGISYKVQNHVEGIGSGIYDGTVNYGSAGRLKSVIHLPVPGLVK
FT                   NGPFLHEIMHYWGNQGFVPTTVGGHWGYANVGGQLGGFDALVELGNNTYQGKMEGENGF
FT                   GTFANGGNSVPYGNLELYLMGLVGVDELKDIQYADNPESQGSGKFTADEIITRTPAQLV
FT                   SEHGSRIPSVQDSQKEFTGITVILSHEKMSDSELANISTNLENFSRKSAPDGSWNGLYN
FT                   FWQATQEKATLTIQLSEDNLK"
     MIPTYPKRAV TTVQTFFLVF FLIISSCSKD NVVDILDSEE NGENENPIAP DDSQLENNFV        60
     LDESNRVVNY ILPKIEYDKY LEDEGDFSLI SKKIYEHFND DFDFIFVLSN EEEVPQDLYY       120
     GISYKVQNHV EGIGSGIYDG TVNYGSAGRL KSVIHLPVPG LVKNGPFLHE IMHYWGNQGF       180
     VPTTVGGHWG YANVGGQLGG FDALVELGNN TYQGKMEGEN GFGTFANGGN SVPYGNLELY       240
     LMGLVGVDEL KDIQYADNPE SQGSGKFTAD EIITRTPAQL VSEHGSRIPS VQDSQKEFTG       300
     ITVILSHEKM SDSELANIST NLENFSRKSA PDGSWNGLYN FWQATQEKAT LTIQLSEDNL       360
     K                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page