(data stored in ACNUC7421 zone)

EMBL: CP002157.PE155

CP002157.PE155       Location/Qualifiers
FT   CDS             complement(180719..182041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16906"
FT                   /product="cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16906"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00784"
FT                   /db_xref="GOA:A4ATL4"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATL4"
FT                   /protein_id="EAR00784.1"
FT                   /translation="MEQGKYSVGLDIGTTKIVAIIGKENEYGKIEILGIGRSKSLGVHR
FT                   GVVNNITQTIQSIQQAVEEAEVNSGLKIGSVVVGIAGQHIRSLQHSDYITRADAEEVIN
FT                   EDDLDRLCNQVYKLVMLPGEEIIHVLPQEYKVDGQAEIKEPIGMYGGRLEANFHVVVGQ
FT                   VSSIKNVGRCIKSAGLDLGKITLEPLASSDAVLSQEEKEAGVALIDIGGGTTDLAIFKD
FT                   GIIRHTAVIPFGGGVITEDIKEGCSIIEKQAELLKIKFGSAWPGENKDNEIVSIPGLRG
FT                   REPKEITLKNLSKIIHARVVEIIEQVYVEIKNYGHEEQKKKLIAGIVLTGGGSQLKHLK
FT                   QLVEYITGMDTRIGYPNEHLAGDTDEAVASPLYATAVGLLMNAVKNNGMDIISHEEEVQ
FT                   EEMAYADSESMKTSSKIPAGERKTVFDKWSEKLKDFLDNAE"
     MEQGKYSVGL DIGTTKIVAI IGKENEYGKI EILGIGRSKS LGVHRGVVNN ITQTIQSIQQ        60
     AVEEAEVNSG LKIGSVVVGI AGQHIRSLQH SDYITRADAE EVINEDDLDR LCNQVYKLVM       120
     LPGEEIIHVL PQEYKVDGQA EIKEPIGMYG GRLEANFHVV VGQVSSIKNV GRCIKSAGLD       180
     LGKITLEPLA SSDAVLSQEE KEAGVALIDI GGGTTDLAIF KDGIIRHTAV IPFGGGVITE       240
     DIKEGCSIIE KQAELLKIKF GSAWPGENKD NEIVSIPGLR GREPKEITLK NLSKIIHARV       300
     VEIIEQVYVE IKNYGHEEQK KKLIAGIVLT GGGSQLKHLK QLVEYITGMD TRIGYPNEHL       360
     AGDTDEAVAS PLYATAVGLL MNAVKNNGMD IISHEEEVQE EMAYADSESM KTSSKIPAGE       420
     RKTVFDKWSE KLKDFLDNAE                                                   440
//

If you have problems or comments...

PBIL Back to PBIL home page