(data stored in ACNUC7421 zone)

EMBL: CP002157.PE156

CP002157.PE156       Location/Qualifiers
FT   CDS             complement(182050..182769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16911"
FT                   /product="putative cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16911"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00785"
FT                   /db_xref="GOA:A4ATL5"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATL5"
FT                   /protein_id="EAR00785.1"
FT                   /translation="MRINWNYIKMIALLLVIMGLYAFSNHRSKEKSVKGLNIEFVGDQN
FT                   LYITQGMVNKLLIQNYGPLTNVPKENLVLNTIEKVIEANEMVKSAQVYLTVNGELTSKI
FT                   VQRKPIGRIEGNSKFYLDDEGKSMPLSMSHSARVPIITGKVTGKSLEDVYEILKYINQD
FT                   DFLRKNVIGIHIEDDERYQLKFRMEQFVVNLGGVDNLEEKFNNFKAFYVKANKDETLEE
FT                   YNVVSLEFNNQVVCTKI"
     MRINWNYIKM IALLLVIMGL YAFSNHRSKE KSVKGLNIEF VGDQNLYITQ GMVNKLLIQN        60
     YGPLTNVPKE NLVLNTIEKV IEANEMVKSA QVYLTVNGEL TSKIVQRKPI GRIEGNSKFY       120
     LDDEGKSMPL SMSHSARVPI ITGKVTGKSL EDVYEILKYI NQDDFLRKNV IGIHIEDDER       180
     YQLKFRMEQF VVNLGGVDNL EEKFNNFKAF YVKANKDETL EEYNVVSLEF NNQVVCTKI        239
//

If you have problems or comments...

PBIL Back to PBIL home page