(data stored in ACNUC7421 zone)

EMBL: CP002157.PE159

CP002157.PE159       Location/Qualifiers
FT   CDS             complement(185190..186389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16926"
FT                   /product="putative transmembrane rod-shape determining
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16926"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00788"
FT                   /db_xref="GOA:A4ATL8"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATL8"
FT                   /protein_id="EAR00788.1"
FT                   /translation="MLNFFKNIKGDKAIWAVVALLALFSFLPVYSASSNLVYVVGNGTT
FT                   SGHLIKHALLLFLGFGIIYGVHKIPAHFFKGLSLIAMPIVLVLLVFTLAQGTTIDGANA
FT                   SRWIRIPLVGFTFQTSNLAAVVLMIYVARYLTKIKDDVITFKESILPLWVPVFLVIILI
FT                   LPANFSTAAIIFSMVLLLCFLGGYPMKYLMGIIGTGILCLTIFVLTAKAAPDLFPNRVD
FT                   TWISRIENFSNPEDTEADYQIERAKIAVASGGIVGKGAGKSVQKNFLPQSSSDFIYAII
FT                   VEEYGLVGGFVLMFFYLLLLFRIVVVANGSQTIFGKLLVLGVGLPIVFQALINMAVAVE
FT                   LFPVTGQTLPLISSGGTSSWMTCLAIGIILSASRKSDILEREDTEIDDTNPLEVLSGQL
FT                   "
     MLNFFKNIKG DKAIWAVVAL LALFSFLPVY SASSNLVYVV GNGTTSGHLI KHALLLFLGF        60
     GIIYGVHKIP AHFFKGLSLI AMPIVLVLLV FTLAQGTTID GANASRWIRI PLVGFTFQTS       120
     NLAAVVLMIY VARYLTKIKD DVITFKESIL PLWVPVFLVI ILILPANFST AAIIFSMVLL       180
     LCFLGGYPMK YLMGIIGTGI LCLTIFVLTA KAAPDLFPNR VDTWISRIEN FSNPEDTEAD       240
     YQIERAKIAV ASGGIVGKGA GKSVQKNFLP QSSSDFIYAI IVEEYGLVGG FVLMFFYLLL       300
     LFRIVVVANG SQTIFGKLLV LGVGLPIVFQ ALINMAVAVE LFPVTGQTLP LISSGGTSSW       360
     MTCLAIGIIL SASRKSDILE REDTEIDDTN PLEVLSGQL                              399
//

If you have problems or comments...

PBIL Back to PBIL home page