(data stored in ACNUC7421 zone)

EMBL: CP002157.PE163

CP002157.PE163       Location/Qualifiers
FT   CDS             complement(190432..192438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16946"
FT                   /product="penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16946"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00792"
FT                   /db_xref="GOA:A4ATM2"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATM2"
FT                   /protein_id="EAR00792.1"
FT                   /translation="MAVTEKSILTRLYVVAGCLFLFAGIVLFKLVSIQMVHGEKYRGLA
FT                   MKRTEKVFTIAPNRGNLYSDDGSLLATSVSRYTIRFDAVTVSDTDFKEQVKPLSNSLSK
FT                   LTGKTSSYYQQLLRKAKANKNRYTLLARNLDYSDYMSVKEFPLLNKGPYKGGLIVEQKT
FT                   VREHPLGKIAERSVGYERKDENGYYTRVGLEGAFGQYLRGVEGKRLKQKIAKGQWKPIG
FT                   MDNIIEPKDGYDVISTIDINIQDIAHHALLKQLEHYKADHGTVIVMETKTGEVKAISNL
FT                   GMTKEGKYYERLNYAIGESHEPGSTFKLMNMVAALEDAVIDTSAVVDTGKGSWKIYKHR
FT                   VKDSKHGGYGKISFAKAFEVSSNTAFAQVIHNNYKENPERYVNRLRGMQLHQELGLPIK
FT                   GEGTPVLRNPGDKGWSGLSLAQMAYGYEVSMTPLQVLTFYNAIANDGEMVKPRMIKEVK
FT                   EWNRSVIKFEKEVINPSICSEETAAKVKQLLKNVVEKKHGTGHKLYSPNFSMAGKTGTA
FT                   QKNYVSKDPDKLRYISTFAGYFPAEEPKYSCIVVIHEPDKSVGYYGADVSGPVFKSVAQ
FT                   KVYATNPLIDEVQMLNSENQKLDESYQKYYVEAQKKYNKVPNVKGMCGMDAVSILENLG
FT                   IKVEVRGNGKVKKQSISHGTDINKVDKIVLDLS"
     MAVTEKSILT RLYVVAGCLF LFAGIVLFKL VSIQMVHGEK YRGLAMKRTE KVFTIAPNRG        60
     NLYSDDGSLL ATSVSRYTIR FDAVTVSDTD FKEQVKPLSN SLSKLTGKTS SYYQQLLRKA       120
     KANKNRYTLL ARNLDYSDYM SVKEFPLLNK GPYKGGLIVE QKTVREHPLG KIAERSVGYE       180
     RKDENGYYTR VGLEGAFGQY LRGVEGKRLK QKIAKGQWKP IGMDNIIEPK DGYDVISTID       240
     INIQDIAHHA LLKQLEHYKA DHGTVIVMET KTGEVKAISN LGMTKEGKYY ERLNYAIGES       300
     HEPGSTFKLM NMVAALEDAV IDTSAVVDTG KGSWKIYKHR VKDSKHGGYG KISFAKAFEV       360
     SSNTAFAQVI HNNYKENPER YVNRLRGMQL HQELGLPIKG EGTPVLRNPG DKGWSGLSLA       420
     QMAYGYEVSM TPLQVLTFYN AIANDGEMVK PRMIKEVKEW NRSVIKFEKE VINPSICSEE       480
     TAAKVKQLLK NVVEKKHGTG HKLYSPNFSM AGKTGTAQKN YVSKDPDKLR YISTFAGYFP       540
     AEEPKYSCIV VIHEPDKSVG YYGADVSGPV FKSVAQKVYA TNPLIDEVQM LNSENQKLDE       600
     SYQKYYVEAQ KKYNKVPNVK GMCGMDAVSI LENLGIKVEV RGNGKVKKQS ISHGTDINKV       660
     DKIVLDLS                                                                668
//

If you have problems or comments...

PBIL Back to PBIL home page