(data stored in ACNUC7421 zone)

EMBL: CP002157.PE169

CP002157.PE169       Location/Qualifiers
FT   CDS             195163..195774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16976"
FT                   /product="putative GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16976"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00798"
FT                   /db_xref="GOA:A4ATM8"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATM8"
FT                   /protein_id="EAR00798.1"
FT                   /translation="MKIKSADFVMSNSDVAKCPNEPLPEYAFIGRSNVGKSSLINMLTE
FT                   RKSLAKTSGRPGKTQLINHFKINGNWFLVDLPGYGYARVSKKDKRTFQKYITDYFIKRK
FT                   QLVSAFVLVDIRHEPQKVDMEFMEYLGENMIPFSIIFTKADKLKPKQMEANVNSYVKEL
FT                   LNGVWEEAPNYFVTSSSKNMGRDELLHYIESINQEFFKEN"
     MKIKSADFVM SNSDVAKCPN EPLPEYAFIG RSNVGKSSLI NMLTERKSLA KTSGRPGKTQ        60
     LINHFKINGN WFLVDLPGYG YARVSKKDKR TFQKYITDYF IKRKQLVSAF VLVDIRHEPQ       120
     KVDMEFMEYL GENMIPFSII FTKADKLKPK QMEANVNSYV KELLNGVWEE APNYFVTSSS       180
     KNMGRDELLH YIESINQEFF KEN                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page