(data stored in ACNUC7421 zone)

EMBL: CP002157.PE171

CP002157.PE171       Location/Qualifiers
FT   CDS             196226..197860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16986"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16986"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00800"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATN0"
FT                   /protein_id="EAR00800.1"
FT                   /translation="MTKILPMRKTLILSLFFICILGCAEQKKEQIPPVISPFSNVDTLS
FT                   INDWWNRKNNPIINLKVNRDSVLAFGIYTVSNRTLKLSAQLYPLYPEETREVRLEIEEN
FT                   GMWREIQNQIVNDLGWSALFRVEDWDDSNNYKYRLRHGEKSTFEGLIRKDPKNKNEVVL
FT                   AALSCNSNKDRGLRENYVRNINHQNPDLMFFAGDQSYDHTEHTAAWLKFGLQFKETFRN
FT                   RPCITIPDDHDIGQGNLWGENGKVSTAKGSPDGGYRYHPEYVKMVERCQTSHLPDPYDP
FT                   TPVEQGIGVYYTNLLLGDIDFAILEDRKFKSGPKGKIPQQGPRPDHIRNPEYDPASIDL
FT                   EGLKLLGNRQLHFLEDWGNQNTELVKVVLSQTGFCGGAHIHGQKENRLHADLDSNGWPQ
FT                   TGRNKALGLIKKASAVHIAGDQHLATVIKQGIHEFGDGPWAFVVPAIVNDYYSRWWWPE
FT                   DEKAGANPNTNTSLPWTGDYLDGFNNKISMYAYVNPESSSKGGGYGLIRFNTKSNETTF
FT                   ECWPRYVDVTQPNAQQFEGWPMTVKIK"
     MTKILPMRKT LILSLFFICI LGCAEQKKEQ IPPVISPFSN VDTLSINDWW NRKNNPIINL        60
     KVNRDSVLAF GIYTVSNRTL KLSAQLYPLY PEETREVRLE IEENGMWREI QNQIVNDLGW       120
     SALFRVEDWD DSNNYKYRLR HGEKSTFEGL IRKDPKNKNE VVLAALSCNS NKDRGLRENY       180
     VRNINHQNPD LMFFAGDQSY DHTEHTAAWL KFGLQFKETF RNRPCITIPD DHDIGQGNLW       240
     GENGKVSTAK GSPDGGYRYH PEYVKMVERC QTSHLPDPYD PTPVEQGIGV YYTNLLLGDI       300
     DFAILEDRKF KSGPKGKIPQ QGPRPDHIRN PEYDPASIDL EGLKLLGNRQ LHFLEDWGNQ       360
     NTELVKVVLS QTGFCGGAHI HGQKENRLHA DLDSNGWPQT GRNKALGLIK KASAVHIAGD       420
     QHLATVIKQG IHEFGDGPWA FVVPAIVNDY YSRWWWPEDE KAGANPNTNT SLPWTGDYLD       480
     GFNNKISMYA YVNPESSSKG GGYGLIRFNT KSNETTFECW PRYVDVTQPN AQQFEGWPMT       540
     VKIK                                                                    544
//

If you have problems or comments...

PBIL Back to PBIL home page