(data stored in ACNUC7421 zone)

EMBL: CP002157.PE178

CP002157.PE178       Location/Qualifiers
FT   CDS             204433..204672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17021"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00807"
FT                   /db_xref="InterPro:IPR031493"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATN7"
FT                   /protein_id="EAR00807.1"
FT                   /translation="MILFFGMRPGKEKVQKLHTIKCDFCGQKSTLTAYIRKNYFHLFWI
FT                   KLFKISKNEIIECSHCKRTYYKEEFTTEMKKSLE"
     MILFFGMRPG KEKVQKLHTI KCDFCGQKST LTAYIRKNYF HLFWIKLFKI SKNEIIECSH        60
     CKRTYYKEEF TTEMKKSLE                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page