(data stored in ACNUC7421 zone)

EMBL: CP002157.PE179

CP002157.PE179       Location/Qualifiers
FT   CDS             complement(204694..205776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17026"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00808"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATN8"
FT                   /protein_id="EAR00808.1"
FT                   /translation="MRVITIYLVVFFSTLAVQNVISQEEDYQQKVEFLLRQKEQISLQE
FT                   KEALKFEVEQINKRYEKNQISYEESKVLKETAAKKRALNIENRVAIVENEILLLERNHG
FT                   EVLDVETIDSTGISSIEINFDFKRADGSSLLWEKRRRIKRELKYDRRTYSDFVMAIGLN
FT                   NALIDGRSINDSPYKIGGSRFFEMGWSWRTRVFENTNFLRLNYGFSFQFNGLKPKNNQY
FT                   FVAENGQVELQDFEFDLKKSKIRMDNLVFPVHLEFGPSKLHKTDKTMRYSLRNQFRLGI
FT                   GAYGGFNMGTRQKLKYNRNGENVKDKLKRGYNTNDLVYGLSAYVGFDGVLLYAKYDLNP
FT                   IFKDALIEQNNISLGLRFDL"
     MRVITIYLVV FFSTLAVQNV ISQEEDYQQK VEFLLRQKEQ ISLQEKEALK FEVEQINKRY        60
     EKNQISYEES KVLKETAAKK RALNIENRVA IVENEILLLE RNHGEVLDVE TIDSTGISSI       120
     EINFDFKRAD GSSLLWEKRR RIKRELKYDR RTYSDFVMAI GLNNALIDGR SINDSPYKIG       180
     GSRFFEMGWS WRTRVFENTN FLRLNYGFSF QFNGLKPKNN QYFVAENGQV ELQDFEFDLK       240
     KSKIRMDNLV FPVHLEFGPS KLHKTDKTMR YSLRNQFRLG IGAYGGFNMG TRQKLKYNRN       300
     GENVKDKLKR GYNTNDLVYG LSAYVGFDGV LLYAKYDLNP IFKDALIEQN NISLGLRFDL       360
//

If you have problems or comments...

PBIL Back to PBIL home page