(data stored in ACNUC7421 zone)

EMBL: CP002157.PE18

CP002157.PE18        Location/Qualifiers
FT   CDS             complement(34353..34655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16221"
FT                   /product="sigma-54 modulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16221"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00647"
FT                   /db_xref="GOA:A4AT77"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT77"
FT                   /protein_id="EAR00647.1"
FT                   /translation="MKVNAQSVNFNADRKLLDFVQNRMDKLETFYDKVISSDVYLKVEN
FT                   TSSKENKIVEIKLNVPKDKFVVKKQCKSFEEAVDSACSSLQRKLKKMKEMQRVKV"
     MKVNAQSVNF NADRKLLDFV QNRMDKLETF YDKVISSDVY LKVENTSSKE NKIVEIKLNV        60
     PKDKFVVKKQ CKSFEEAVDS ACSSLQRKLK KMKEMQRVKV                             100
//

If you have problems or comments...

PBIL Back to PBIL home page