(data stored in ACNUC7421 zone)

EMBL: CP002157.PE186

CP002157.PE186       Location/Qualifiers
FT   CDS             complement(211896..212222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17061"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00815"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR012359"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATP5"
FT                   /protein_id="EAR00815.1"
FT                   /translation="MGIQKTQQEVDNWIKEHGVRYFNELTNMAQLTEEVGEVARIIARR
FT                   YGEQSEKESDKGKDLGEELADVLFVVLCLANQTGIDLEEAFNKKMGLKAKRDHDRHQNN
FT                   EKLK"
     MGIQKTQQEV DNWIKEHGVR YFNELTNMAQ LTEEVGEVAR IIARRYGEQS EKESDKGKDL        60
     GEELADVLFV VLCLANQTGI DLEEAFNKKM GLKAKRDHDR HQNNEKLK                    108
//

If you have problems or comments...

PBIL Back to PBIL home page