(data stored in ACNUC7421 zone)

EMBL: CP002157.PE190

CP002157.PE190       Location/Qualifiers
FT   CDS             214711..215151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17081"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00819"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATP9"
FT                   /protein_id="EAR00819.1"
FT                   /translation="MKKLIIVVSLLGLLSYETNAQEYKVITSVESIVSSGLGRSRIISA
FT                   NEDKDYQEFTSVQTDEDKTRNKSKRDEIRVKNFEETKLLNFFNIGGIRFQNIAANDALI
FT                   TSKINTMVAEGWELAFVTSAVESDGGKGDGSGIFITRYIFKR"
     MKKLIIVVSL LGLLSYETNA QEYKVITSVE SIVSSGLGRS RIISANEDKD YQEFTSVQTD        60
     EDKTRNKSKR DEIRVKNFEE TKLLNFFNIG GIRFQNIAAN DALITSKINT MVAEGWELAF       120
     VTSAVESDGG KGDGSGIFIT RYIFKR                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page