(data stored in ACNUC7421 zone)

EMBL: CP002157.PE197

CP002157.PE197       Location/Qualifiers
FT   CDS             complement(221346..222095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17116"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17116"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00826"
FT                   /db_xref="InterPro:IPR021255"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATQ6"
FT                   /protein_id="EAR00826.1"
FT                   /translation="MKKILNILLFMILISCNNENAPDCFQDAGELVRVEVDMDTFAKIT
FT                   VFENVSLILEQGDVQKVEIETGEFLLNEVTAYVEGDRLILQNENGCNFFRDYGLTKVYV
FT                   TSPNITEIRSSTGLPIKSNGVLGYSSIRLYSESFVNPDAETTDGEFDLELNSKNVGVVA
FT                   NGIAYFKLRGNTEHLSVTVAAGDSRIEAEDLVSETISLNHRGTNDIQVNPQQSITGVIR
FT                   GTGDVISFNQPATIEVEELYTGKLIFK"
     MKKILNILLF MILISCNNEN APDCFQDAGE LVRVEVDMDT FAKITVFENV SLILEQGDVQ        60
     KVEIETGEFL LNEVTAYVEG DRLILQNENG CNFFRDYGLT KVYVTSPNIT EIRSSTGLPI       120
     KSNGVLGYSS IRLYSESFVN PDAETTDGEF DLELNSKNVG VVANGIAYFK LRGNTEHLSV       180
     TVAAGDSRIE AEDLVSETIS LNHRGTNDIQ VNPQQSITGV IRGTGDVISF NQPATIEVEE       240
     LYTGKLIFK                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page