(data stored in ACNUC7421 zone)

EMBL: CP002157.PE198

CP002157.PE198       Location/Qualifiers
FT   CDS             complement(222092..223192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17121"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00827"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATQ7"
FT                   /protein_id="EAR00827.1"
FT                   /translation="MNLRLLPIVLLVFSIGFSQSNEKLMKYTLDVNQYYGSIMLHNTDI
FT                   SHLISDHPAGLILSLNRKTYGDEEWHQEYNYPDIGASFIYQNMNNSTLGHNYSLYAHYN
FT                   FYFFKRNMQFRIGQGIAHTSNPYDKYENFRNNAYGSDFMSSTYLMLNYHKENIFKGLGF
FT                   KAGVSIIHYSNANFRAPNTSTNTFAFNAGLIYDLDGGKELAYLVDPEKVNVTEPIKYNL
FT                   VFRAGLNESDVIDMGQYPFYIISAYADKRLGRKSAIQIGADIYFSRFLKELIRFQSIAF
FT                   PENGVSSDDDYKRVGLFLGHELFINEMSIITQLGYYVYYPFDFEGKMYNRVGLKRYFGD
FT                   KIFGAITLKSHGAKAEAVEFGIGVRL"
     MNLRLLPIVL LVFSIGFSQS NEKLMKYTLD VNQYYGSIML HNTDISHLIS DHPAGLILSL        60
     NRKTYGDEEW HQEYNYPDIG ASFIYQNMNN STLGHNYSLY AHYNFYFFKR NMQFRIGQGI       120
     AHTSNPYDKY ENFRNNAYGS DFMSSTYLML NYHKENIFKG LGFKAGVSII HYSNANFRAP       180
     NTSTNTFAFN AGLIYDLDGG KELAYLVDPE KVNVTEPIKY NLVFRAGLNE SDVIDMGQYP       240
     FYIISAYADK RLGRKSAIQI GADIYFSRFL KELIRFQSIA FPENGVSSDD DYKRVGLFLG       300
     HELFINEMSI ITQLGYYVYY PFDFEGKMYN RVGLKRYFGD KIFGAITLKS HGAKAEAVEF       360
     GIGVRL                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page