(data stored in ACNUC7421 zone)

EMBL: CP002157.PE2

CP002157.PE2         Location/Qualifiers
FT   CDS             complement(4721..8113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16141"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00631"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT61"
FT                   /protein_id="EAR00631.1"
FT                   /translation="MRRNSQSFLSKLTFGIILSLLIFYHGETFSQTTFTESAAAYGLNL
FT                   GGNKDGGHAWADYDLDGDFDLVVNTQGNGKLYRNDGGSFTDVTGTLAPDFNGGSLERTV
FT                   LFVDFNNDGYPDVFRNKHNDLRIYLQDPATNRFGNGTGGTVPNQRFTSMTDGMNTEGAG
FT                   ALDYDGDGDLDLFVDNHNFGIDILQNDGTGNFTHVTRKADSPNPPYDVLNSTTWPLGLV
FT                   QDATDGDYGSATDFNDDGWVDIVVRKRDQVDLFTNVGGTFQNGVNIDDANNNNKGAVAF
FT                   YDFDNDGDFDMYWTENGNNQIHRNNGDGTWTGLGAATGIPISFSGQIEGLACGDVDNDG
FT                   DIDIFLAGGANKLFLNQINNGGGAMSFVDSGLTFSNSGGEGCTFIDIDQDGDLDLYTNR
FT                   SGNNRLYINNLMANQANHLYIDIVEDRDAFGLINTEERFGVGATAKILDCDGNVISGTR
FT                   EVNGGFGHGTQGPGRIHFGLPSGPLTPIVVEVSFPRTASGRVVVRQQLIPNDYNNGSIN
FT                   LLDVFPDSANQPPTATDEYTTVVENSFVSLDPLIDNGNGADSDPEGEPLEVISVTQPSN
FT                   GVSVLNGDGTVTYTPTTGFFGNDSFTYTMRDNANCTFTSEEATGSIYITVFPDSDNDTV
FT                   ADRVDLDDDNDGLLDADELNTIISNSQQDCTGETTLDFSSAATLVSGTALQLGAVYRIS
FT                   NITTGTDALVTIDQTFNATVANIDNNGSEPASFRPQTAFNLTNIGDQGYIEYRIQFVNS
FT                   GGSAPVVISKFFTNFNDIDGNSNYGEQIWSDNPTSYIISNPTELTMSTDGSWVLGTAGI
FT                   NEFPGAGNTFPEVNYGVNYNSQSEISIRVGAVARVAGASASGRQHNIEFSCLTNYVNPE
FT                   TYGIDSDSDGIANHLDLDSDNDGIYDAVEAGHSQSHSNGVVNGPYGANGLANVVETAAE
FT                   SGAINYTILDTDGTDPADFLDTDSDDDGCSDANEAYNNANADGGDNEYYATGNPPATDG
FT                   FGRVTGATYPVPADIDTDSTYDHLEVGLAPSISTQPPNTNVCPGCDITIEVIASNSDTY
FT                   QWQLDDGSGWVDLTDSGIYSDTSTSILTITNATAPDNGNEYRVIVSNTMFICSSETSNS
FT                   AVLTLRVNTIITNRRITHRVNKN"
     MRRNSQSFLS KLTFGIILSL LIFYHGETFS QTTFTESAAA YGLNLGGNKD GGHAWADYDL        60
     DGDFDLVVNT QGNGKLYRND GGSFTDVTGT LAPDFNGGSL ERTVLFVDFN NDGYPDVFRN       120
     KHNDLRIYLQ DPATNRFGNG TGGTVPNQRF TSMTDGMNTE GAGALDYDGD GDLDLFVDNH       180
     NFGIDILQND GTGNFTHVTR KADSPNPPYD VLNSTTWPLG LVQDATDGDY GSATDFNDDG       240
     WVDIVVRKRD QVDLFTNVGG TFQNGVNIDD ANNNNKGAVA FYDFDNDGDF DMYWTENGNN       300
     QIHRNNGDGT WTGLGAATGI PISFSGQIEG LACGDVDNDG DIDIFLAGGA NKLFLNQINN       360
     GGGAMSFVDS GLTFSNSGGE GCTFIDIDQD GDLDLYTNRS GNNRLYINNL MANQANHLYI       420
     DIVEDRDAFG LINTEERFGV GATAKILDCD GNVISGTREV NGGFGHGTQG PGRIHFGLPS       480
     GPLTPIVVEV SFPRTASGRV VVRQQLIPND YNNGSINLLD VFPDSANQPP TATDEYTTVV       540
     ENSFVSLDPL IDNGNGADSD PEGEPLEVIS VTQPSNGVSV LNGDGTVTYT PTTGFFGNDS       600
     FTYTMRDNAN CTFTSEEATG SIYITVFPDS DNDTVADRVD LDDDNDGLLD ADELNTIISN       660
     SQQDCTGETT LDFSSAATLV SGTALQLGAV YRISNITTGT DALVTIDQTF NATVANIDNN       720
     GSEPASFRPQ TAFNLTNIGD QGYIEYRIQF VNSGGSAPVV ISKFFTNFND IDGNSNYGEQ       780
     IWSDNPTSYI ISNPTELTMS TDGSWVLGTA GINEFPGAGN TFPEVNYGVN YNSQSEISIR       840
     VGAVARVAGA SASGRQHNIE FSCLTNYVNP ETYGIDSDSD GIANHLDLDS DNDGIYDAVE       900
     AGHSQSHSNG VVNGPYGANG LANVVETAAE SGAINYTILD TDGTDPADFL DTDSDDDGCS       960
     DANEAYNNAN ADGGDNEYYA TGNPPATDGF GRVTGATYPV PADIDTDSTY DHLEVGLAPS      1020
     ISTQPPNTNV CPGCDITIEV IASNSDTYQW QLDDGSGWVD LTDSGIYSDT STSILTITNA      1080
     TAPDNGNEYR VIVSNTMFIC SSETSNSAVL TLRVNTIITN RRITHRVNKN                 1130
//

If you have problems or comments...

PBIL Back to PBIL home page