(data stored in ACNUC7421 zone)

EMBL: CP002157.PE208

CP002157.PE208       Location/Qualifiers
FT   CDS             complement(233612..234511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17171"
FT                   /product="sulfate adenylyltransferase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17171"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00837"
FT                   /db_xref="GOA:A4ATR7"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATR7"
FT                   /protein_id="EAR00837.1"
FT                   /translation="MKDTSNINALENEAIYIMREVAAQFEKPVLLFSGGKDSITLVRLA
FT                   QKAFYPAKIPFPLMHIDTGHNFPETIEFRDRLVEELGLELIVRNVQDSIDQGKVKEESG
FT                   RYSSRNSLQTTTLLDAIEEFKFDACIGGARRDEEKARAKERVFSVRDDFGQWDEKNQRP
FT                   ELFDMLNGQIELGQNVRVFPISNWTELDVWSYIEKEEIEIPSIYFAHKRKIFLRDGLIW
FT                   SHSDYVFQEDHEEVLEKMVRFRTVGDMSCTAAVFSEAADIASVVQEIRESTISERGARI
FT                   DDKRSEAAMEKRKQQGYF"
     MKDTSNINAL ENEAIYIMRE VAAQFEKPVL LFSGGKDSIT LVRLAQKAFY PAKIPFPLMH        60
     IDTGHNFPET IEFRDRLVEE LGLELIVRNV QDSIDQGKVK EESGRYSSRN SLQTTTLLDA       120
     IEEFKFDACI GGARRDEEKA RAKERVFSVR DDFGQWDEKN QRPELFDMLN GQIELGQNVR       180
     VFPISNWTEL DVWSYIEKEE IEIPSIYFAH KRKIFLRDGL IWSHSDYVFQ EDHEEVLEKM       240
     VRFRTVGDMS CTAAVFSEAA DIASVVQEIR ESTISERGAR IDDKRSEAAM EKRKQQGYF        299
//

If you have problems or comments...

PBIL Back to PBIL home page