(data stored in ACNUC7421 zone)

EMBL: CP002157.PE218

CP002157.PE218       Location/Qualifiers
FT   CDS             247605..248219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17221"
FT                   /product="Deoxynucleoside kinase subfamily, putative"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17221"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00847"
FT                   /db_xref="GOA:A4ATS7"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATS7"
FT                   /protein_id="EAR00847.1"
FT                   /translation="MHIAVAGNIGAGKTTLTKLLAKHYKWEAHFEDVVDNPYLDDFYNQ
FT                   MERWSFNLQIYFLNHRYRQVLSFRESGKDIIQDRTIYEDAYIFAPNLHAMGLMTNRDFS
FT                   NYSSLFELMESLVQPPDLLIYLRSSIPNLVSQIHKRGREYENTISIDYLSRLNERYEAW
FT                   IHGYEKGKLLIVDVDNLDFVDNPEDLGEILNKIDAEINGLF"
     MHIAVAGNIG AGKTTLTKLL AKHYKWEAHF EDVVDNPYLD DFYNQMERWS FNLQIYFLNH        60
     RYRQVLSFRE SGKDIIQDRT IYEDAYIFAP NLHAMGLMTN RDFSNYSSLF ELMESLVQPP       120
     DLLIYLRSSI PNLVSQIHKR GREYENTISI DYLSRLNERY EAWIHGYEKG KLLIVDVDNL       180
     DFVDNPEDLG EILNKIDAEI NGLF                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page