(data stored in ACNUC7421 zone)

EMBL: CP002157.PE224

CP002157.PE224       Location/Qualifiers
FT   CDS             complement(255703..256680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17251"
FT                   /product="pyruvate dehydrogenase E1 component, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17251"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00853"
FT                   /db_xref="GOA:A4ATT3"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR027110"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATT3"
FT                   /protein_id="EAR00853.1"
FT                   /translation="MKTLQFRQAIAEAMSEEMRTDESIYLMGEEVAEYNGAYKASKGML
FT                   DEFGPDRVIDTPISELGFAGIGVGSTLTGNRPIIEFMTFNFALVGIDQIINNAAKIRQM
FT                   SGGQFSCPIVFRGPTGSAGQLAATHSQAFESWFANCPGLKVVVPSNPADAKGLLKSAIR
FT                   DNDPVIFMESEQMYGDKGEVPEGEYTIPLGVADIRREGSDVTIVSFGKIIKQADKAADE
FT                   LSKDGISCEIIDLRTVKPLDYEAILNSVKKTNRLVILEEAWPYGNVASEITFHVQSNAF
FT                   DYLDAPIQKINTADTPAPYSPVLLAEWLPDHEDVINAVKKVLYK"
     MKTLQFRQAI AEAMSEEMRT DESIYLMGEE VAEYNGAYKA SKGMLDEFGP DRVIDTPISE        60
     LGFAGIGVGS TLTGNRPIIE FMTFNFALVG IDQIINNAAK IRQMSGGQFS CPIVFRGPTG       120
     SAGQLAATHS QAFESWFANC PGLKVVVPSN PADAKGLLKS AIRDNDPVIF MESEQMYGDK       180
     GEVPEGEYTI PLGVADIRRE GSDVTIVSFG KIIKQADKAA DELSKDGISC EIIDLRTVKP       240
     LDYEAILNSV KKTNRLVILE EAWPYGNVAS EITFHVQSNA FDYLDAPIQK INTADTPAPY       300
     SPVLLAEWLP DHEDVINAVK KVLYK                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page