(data stored in ACNUC7421 zone)

EMBL: CP002157.PE225

CP002157.PE225       Location/Qualifiers
FT   CDS             256865..257611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17256"
FT                   /product="electron transfer flavoprotein (beta subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17256"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00854"
FT                   /db_xref="GOA:A4ATT4"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATT4"
FT                   /protein_id="EAR00854.1"
FT                   /translation="MKILVCISNVPDTTSKINFTDGDTKFDTNGVQFVINPNDEFGLTR
FT                   AMWFKEKQGAAVHVATVGGPSSESTIRKALAIGADEAIRVNAEPTDGYFVAQQLAEVVK
FT                   NGGYDLVIAGRESIDYNGGMVPGILATLLGMNFVNTCIELEVEGNNATATREIDGGKEK
FT                   LSTTLPLVIGGQKGLVDESDLRIPNMRGIMMARKKVLNVVEPVDAIKATSDVKFDKPAP
FT                   KGAVKLVDASNVEELINLLHNEAKVI"
     MKILVCISNV PDTTSKINFT DGDTKFDTNG VQFVINPNDE FGLTRAMWFK EKQGAAVHVA        60
     TVGGPSSEST IRKALAIGAD EAIRVNAEPT DGYFVAQQLA EVVKNGGYDL VIAGRESIDY       120
     NGGMVPGILA TLLGMNFVNT CIELEVEGNN ATATREIDGG KEKLSTTLPL VIGGQKGLVD       180
     ESDLRIPNMR GIMMARKKVL NVVEPVDAIK ATSDVKFDKP APKGAVKLVD ASNVEELINL       240
     LHNEAKVI                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page