(data stored in ACNUC7421 zone)

EMBL: CP002157.PE226

CP002157.PE226       Location/Qualifiers
FT   CDS             257656..258624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17261"
FT                   /product="electron transfer flavoprotein, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17261"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00855"
FT                   /db_xref="GOA:A4ATT5"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATT5"
FT                   /protein_id="EAR00855.1"
FT                   /translation="MSVLVYTESDNGKFKKNAFEVASYASEVAKQLGSSVTAISFNSTE
FT                   NESLGKYGVSKVLNVSNEQLNTFNAKAFANAITEAASKESASVIVVSSSSDTKYLAPII
FT                   AAKLSAGYVSNVVAAPESTSPFTVKRSAFSNKGFAHTQINTDTKVIGVSNNSFGAVENN
FT                   TTASVEDFNPSLNDADFSTKSIEIDKVVGQATIADADIVVSGGRGLKGPENWGMIEELA
FT                   DVLGAATACSKPVSDMGWRPHSEHVGQTGKPVASNLYIAIGISGAIQHLAGVSASKTKV
FT                   VINTDAEAPFFKAADYGIVGDAFEVVPKLIEKLKEFKAQNT"
     MSVLVYTESD NGKFKKNAFE VASYASEVAK QLGSSVTAIS FNSTENESLG KYGVSKVLNV        60
     SNEQLNTFNA KAFANAITEA ASKESASVIV VSSSSDTKYL APIIAAKLSA GYVSNVVAAP       120
     ESTSPFTVKR SAFSNKGFAH TQINTDTKVI GVSNNSFGAV ENNTTASVED FNPSLNDADF       180
     STKSIEIDKV VGQATIADAD IVVSGGRGLK GPENWGMIEE LADVLGAATA CSKPVSDMGW       240
     RPHSEHVGQT GKPVASNLYI AIGISGAIQH LAGVSASKTK VVINTDAEAP FFKAADYGIV       300
     GDAFEVVPKL IEKLKEFKAQ NT                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page