(data stored in ACNUC7421 zone)

EMBL: CP002157.PE227

CP002157.PE227       Location/Qualifiers
FT   CDS             258714..259343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17266"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00856"
FT                   /db_xref="GOA:A4ATT6"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003729"
FT                   /db_xref="InterPro:IPR036104"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATT6"
FT                   /protein_id="EAR00856.1"
FT                   /translation="MSLVRLKIKGISYSQTQNGAYALILNEVDGDRKLPIVIGAFEAQS
FT                   IAIALEKEIKPPRPLTHDLFKNFADRFDIVVKQVIIHKLVDGVFYSSIICERDKIEEII
FT                   DARTSDAIALALRFSAPIFTYKTILDKAGIFLKFSSKDSDKDENDDSIMVDEILQEGET
FT                   VEIDTGATDAYTELTIDELKKELDKAVANEDYEKAAKLRDEISKRN"
     MSLVRLKIKG ISYSQTQNGA YALILNEVDG DRKLPIVIGA FEAQSIAIAL EKEIKPPRPL        60
     THDLFKNFAD RFDIVVKQVI IHKLVDGVFY SSIICERDKI EEIIDARTSD AIALALRFSA       120
     PIFTYKTILD KAGIFLKFSS KDSDKDENDD SIMVDEILQE GETVEIDTGA TDAYTELTID       180
     ELKKELDKAV ANEDYEKAAK LRDEISKRN                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page