(data stored in ACNUC7421 zone)

EMBL: CP002157.PE231

CP002157.PE231       Location/Qualifiers
FT   CDS             262350..262736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17286"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00860"
FT                   /db_xref="GOA:A4ATU0"
FT                   /db_xref="InterPro:IPR025698"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATU0"
FT                   /protein_id="EAR00860.1"
FT                   /translation="MFAKEKNKTELNLEQHELLETAQERIKQKKKLYSHFVVFLIGSVF
FT                   LILINKILKFGVEYDWFIWAITFWAFLFVMHVFNVFITQNFMGKDWERKQREKLVLKQK
FT                   DRIAEIQKEIETDFPLSKINKKKL"
     MFAKEKNKTE LNLEQHELLE TAQERIKQKK KLYSHFVVFL IGSVFLILIN KILKFGVEYD        60
     WFIWAITFWA FLFVMHVFNV FITQNFMGKD WERKQREKLV LKQKDRIAEI QKEIETDFPL       120
     SKINKKKL                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page