(data stored in ACNUC7421 zone)

EMBL: CP002157.PE235

CP002157.PE235       Location/Qualifiers
FT   CDS             265775..266572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17306"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00864"
FT                   /db_xref="GOA:A4ATU4"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATU4"
FT                   /protein_id="EAR00864.1"
FT                   /translation="MKVKRHSLFLFLPSEVYIYSMNYLASIGSYAIMIKEVFRKPTKWS
FT                   IMRSLILKEIDELIFGSLGILIFISFFIGGVVAIQTALNITSELIPKNLVGFATRQSII
FT                   LEFAPTFCSIIMAGKVGSYITSSIGTMRVTEQIDALEVMGVNALNYLVFPKIIALLLYP
FT                   FIIAISMYVGIFGGWFAGVFGGFSTSADFVEGVQLDFIPFHVTYSFIKTLVFAFILATI
FT                   PSYHGFYMKGGALEVGKAATTSFVWTSVVIIILNYILTQLLLG"
     MKVKRHSLFL FLPSEVYIYS MNYLASIGSY AIMIKEVFRK PTKWSIMRSL ILKEIDELIF        60
     GSLGILIFIS FFIGGVVAIQ TALNITSELI PKNLVGFATR QSIILEFAPT FCSIIMAGKV       120
     GSYITSSIGT MRVTEQIDAL EVMGVNALNY LVFPKIIALL LYPFIIAISM YVGIFGGWFA       180
     GVFGGFSTSA DFVEGVQLDF IPFHVTYSFI KTLVFAFILA TIPSYHGFYM KGGALEVGKA       240
     ATTSFVWTSV VIIILNYILT QLLLG                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page