(data stored in ACNUC7421 zone)

EMBL: CP002157.PE239

CP002157.PE239       Location/Qualifiers
FT   CDS             complement(269895..270497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17326"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00868"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATU8"
FT                   /protein_id="EAR00868.1"
FT                   /translation="MDDILQKYLPERAVEPCLQLIKESGVNLKIVNQRITRHGDYRRLP
FT                   NGLHQITVNASLNKYRFLITLIHEIAHLAAFVEYGRNIKPHGLEWKRTFQYLMLPFIRP
FT                   EIFPSKLLPLLARHFRNPKASSDTDAVLSLALKQYDQQQSDKSFVFELPSGSVFRLYNG
FT                   KLFRKGKKRVKRYECIEITSGKIYLFQPNAEVELIKD"
     MDDILQKYLP ERAVEPCLQL IKESGVNLKI VNQRITRHGD YRRLPNGLHQ ITVNASLNKY        60
     RFLITLIHEI AHLAAFVEYG RNIKPHGLEW KRTFQYLMLP FIRPEIFPSK LLPLLARHFR       120
     NPKASSDTDA VLSLALKQYD QQQSDKSFVF ELPSGSVFRL YNGKLFRKGK KRVKRYECIE       180
     ITSGKIYLFQ PNAEVELIKD                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page