(data stored in ACNUC7421 zone)

EMBL: CP002157.PE240

CP002157.PE240       Location/Qualifiers
FT   CDS             270620..270970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17331"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00869"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATU9"
FT                   /protein_id="EAR00869.1"
FT                   /translation="MPKNTYRVYVIELSKRVFSENAKFRAANPQFNGVLQCLYVGMTSK
FT                   TPKERFEQHKSGYRNKKGYKLSSNLVQKYGMYLRSSLYNHIDPLSTREKALKMEELLTM
FT                   ELRRKGYAVWYN"
     MPKNTYRVYV IELSKRVFSE NAKFRAANPQ FNGVLQCLYV GMTSKTPKER FEQHKSGYRN        60
     KKGYKLSSNL VQKYGMYLRS SLYNHIDPLS TREKALKMEE LLTMELRRKG YAVWYN           116
//

If you have problems or comments...

PBIL Back to PBIL home page