(data stored in ACNUC7421 zone)

EMBL: CP002157.PE247

CP002157.PE247       Location/Qualifiers
FT   CDS             complement(276485..277480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17366"
FT                   /product="pyruvate dehydrogenase complex, E1 component,
FT                   pyruvate dehydrogenase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17366"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00876"
FT                   /db_xref="GOA:A4ATV6"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017597"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATV6"
FT                   /protein_id="EAR00876.1"
FT                   /translation="MEKITKETYLKWYEDMLFWRKFEDKLAAVYIQQKVRGFLHLYNGQ
FT                   EAVLAGALHAMDLTKDRMITAYRNHVQPIGMGVDPKNVMAELYGKVTGTSKGMGGSMHI
FT                   FSKEHRFYGGHGIVGGQIPLGAGLAFADKYFKRDSVTLCYMGDGAVRQGSLHETFNLAM
FT                   LWNLPVVFVCENNGYAMGTSVSRTASHEEIWKLGLGYEMPCGPVDGMDPVTVAKEMSKA
FT                   IERARNGDGPTFLEMKTYRYRGHSMSDAQHYRTKDEVEEYKKIDPISQVKEVIFEKEYA
FT                   SEDEIKEIDQRVKELVLECEKFAEDSDYPPVNQLYDVVYDQEDFPFVQHK"
     MEKITKETYL KWYEDMLFWR KFEDKLAAVY IQQKVRGFLH LYNGQEAVLA GALHAMDLTK        60
     DRMITAYRNH VQPIGMGVDP KNVMAELYGK VTGTSKGMGG SMHIFSKEHR FYGGHGIVGG       120
     QIPLGAGLAF ADKYFKRDSV TLCYMGDGAV RQGSLHETFN LAMLWNLPVV FVCENNGYAM       180
     GTSVSRTASH EEIWKLGLGY EMPCGPVDGM DPVTVAKEMS KAIERARNGD GPTFLEMKTY       240
     RYRGHSMSDA QHYRTKDEVE EYKKIDPISQ VKEVIFEKEY ASEDEIKEID QRVKELVLEC       300
     EKFAEDSDYP PVNQLYDVVY DQEDFPFVQH K                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page