(data stored in ACNUC7421 zone)

EMBL: CP002157.PE25

CP002157.PE25        Location/Qualifiers
FT   CDS             complement(40735..40962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16256"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00654"
FT                   /db_xref="GOA:A4AT84"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT84"
FT                   /protein_id="EAR00654.1"
FT                   /translation="MNVFYQPLYYFQKRGFEVCRRIAERIGIRARVVRTSFIYLTFVTL
FT                   GFGFALYLFLAFWLKIKDLVHTKRTSVFDL"
     MNVFYQPLYY FQKRGFEVCR RIAERIGIRA RVVRTSFIYL TFVTLGFGFA LYLFLAFWLK        60
     IKDLVHTKRT SVFDL                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page