(data stored in ACNUC7421 zone)

EMBL: CP002157.PE250

CP002157.PE250       Location/Qualifiers
FT   CDS             complement(278242..279387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17381"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00879"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATV9"
FT                   /protein_id="EAR00879.1"
FT                   /translation="MKKLTLLVLLAFAIQLSAQDDRVITTAVPFLTIAADARSAGMGDM
FT                   GVATSTDAFSQQWNPSKFAFAERKMGIGVSYTPYLESIITDISLLNASFYNKIDDQSAF
FT                   ALSLRYFTLGEIELRQFANDPGTLAKPNELALDGSYSLKLSPTFSMAVGGRFIRSNLKL
FT                   PQNGSEDSQAASTFAVDVSGYYRSREIAYDKFDGRWRAGFNLSNLGGKITYDEGGQENF
FT                   LPTNLKFGAGFDFILDQDNVLGITTEFNKLLVPTPQDFDEDGDIDSADNDEYQQIGFFS
FT                   GITKSFNDAPDGFSEELKEFTWALGAEYTYQDAFMIRTGYFNESEEKGSRKFFTMGAGF
FT                   KFKAAQIDLSYLFSTSQVKNPLENTLRFSLTFNLGEEYLND"
     MKKLTLLVLL AFAIQLSAQD DRVITTAVPF LTIAADARSA GMGDMGVATS TDAFSQQWNP        60
     SKFAFAERKM GIGVSYTPYL ESIITDISLL NASFYNKIDD QSAFALSLRY FTLGEIELRQ       120
     FANDPGTLAK PNELALDGSY SLKLSPTFSM AVGGRFIRSN LKLPQNGSED SQAASTFAVD       180
     VSGYYRSREI AYDKFDGRWR AGFNLSNLGG KITYDEGGQE NFLPTNLKFG AGFDFILDQD       240
     NVLGITTEFN KLLVPTPQDF DEDGDIDSAD NDEYQQIGFF SGITKSFNDA PDGFSEELKE       300
     FTWALGAEYT YQDAFMIRTG YFNESEEKGS RKFFTMGAGF KFKAAQIDLS YLFSTSQVKN       360
     PLENTLRFSL TFNLGEEYLN D                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page