(data stored in ACNUC7421 zone)

EMBL: CP002157.PE257

CP002157.PE257       Location/Qualifiers
FT   CDS             complement(288417..289319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17416"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00886"
FT                   /db_xref="GOA:A4ATW6"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATW6"
FT                   /protein_id="EAR00886.1"
FT                   /translation="MSFLDTRHKKKSFTLTTALLSVLLLLLFYIGLTYMDPPIENGISV
FT                   NFGTMDFGMGDNQPKEKIRSEPLDIPEPPNVQEEVQEAEAVPEQVVEEVVEKEQPTEKV
FT                   LTQESEESIKIKQQQEAKRKADAAAKKAKAEADRVAREKREAEEQKRQEQAAKKAELDK
FT                   LMGGLNKSDGSATGSEGDDNRPGDKGQPDGDPYATSYYGSPGSGSGTGGYGLNGRSLVS
FT                   KGKVKQDCNQEGRVVVKIVVDRNGKVISATPGVKGTTNRAECLLIPAKKTAFMHKWNLD
FT                   SNAPNQQIGFVVVNFKLGG"
     MSFLDTRHKK KSFTLTTALL SVLLLLLFYI GLTYMDPPIE NGISVNFGTM DFGMGDNQPK        60
     EKIRSEPLDI PEPPNVQEEV QEAEAVPEQV VEEVVEKEQP TEKVLTQESE ESIKIKQQQE       120
     AKRKADAAAK KAKAEADRVA REKREAEEQK RQEQAAKKAE LDKLMGGLNK SDGSATGSEG       180
     DDNRPGDKGQ PDGDPYATSY YGSPGSGSGT GGYGLNGRSL VSKGKVKQDC NQEGRVVVKI       240
     VVDRNGKVIS ATPGVKGTTN RAECLLIPAK KTAFMHKWNL DSNAPNQQIG FVVVNFKLGG       300
//

If you have problems or comments...

PBIL Back to PBIL home page