(data stored in ACNUC7421 zone)

EMBL: CP002157.PE261

CP002157.PE261       Location/Qualifiers
FT   CDS             complement(291813..293045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17436"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17436"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00890"
FT                   /db_xref="GOA:A4ATX0"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATX0"
FT                   /protein_id="EAR00890.1"
FT                   /translation="MKELLQAYENKQPEIVFNWKDSETEAEGWTVINSLRGGAAGGGTR
FT                   MREGLDLNEVLSLAKTMEVKFTVSGPPIGGAKSGINFNPHDPRKKGVLQRWYRAVSPLL
FT                   KSYYGTGGDLNVDEIHEVIPITEDAGVWHPQEGVFNGHFKPTEADKINRIGQLRQGVIK
FT                   PIESELYTPDVSRKYTIADMITGYGVAEAVRHYYDIFGGNVMGKKAVVQGFGNVGGAAA
FT                   FYLAQMGAKIVGILDRTGGVINEEGFSFEEIKDFFLNKHNNNLMASADQMIPFEEIKER
FT                   IWTLQTEIFVPCAASRLITKNQISKMIDTGLEVISCGANVPFADKEIFFGPIMEYTDGR
FT                   VSLIPDFVSNCGMARVFAYFMEKRVGIDDDLIFKDTSDTIRKAILNIFKQNHTKLNLSK
FT                   TGFEIALKQLV"
     MKELLQAYEN KQPEIVFNWK DSETEAEGWT VINSLRGGAA GGGTRMREGL DLNEVLSLAK        60
     TMEVKFTVSG PPIGGAKSGI NFNPHDPRKK GVLQRWYRAV SPLLKSYYGT GGDLNVDEIH       120
     EVIPITEDAG VWHPQEGVFN GHFKPTEADK INRIGQLRQG VIKPIESELY TPDVSRKYTI       180
     ADMITGYGVA EAVRHYYDIF GGNVMGKKAV VQGFGNVGGA AAFYLAQMGA KIVGILDRTG       240
     GVINEEGFSF EEIKDFFLNK HNNNLMASAD QMIPFEEIKE RIWTLQTEIF VPCAASRLIT       300
     KNQISKMIDT GLEVISCGAN VPFADKEIFF GPIMEYTDGR VSLIPDFVSN CGMARVFAYF       360
     MEKRVGIDDD LIFKDTSDTI RKAILNIFKQ NHTKLNLSKT GFEIALKQLV                  410
//

If you have problems or comments...

PBIL Back to PBIL home page