(data stored in ACNUC7421 zone)

EMBL: CP002157.PE264

CP002157.PE264       Location/Qualifiers
FT   CDS             299292..300758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_17451"
FT                   /product="NADPH-dependent glutamate synthase, small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_17451"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00893"
FT                   /db_xref="GOA:A4ATX3"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATX3"
FT                   /protein_id="EAR00893.1"
FT                   /translation="MGKTTGFLEFDRKVEGYTSVEKRVKHYKEFTVPMKAKELKDQGAR
FT                   CMDCGIPFCHSGCPLGNLIPDFNDAVYRGKWEKATKILHATNNFPEFTGRLCPAPCEEA
FT                   CVLGINEDPVTIENIEKNIVETAFKNGWITASSPANRTGKTVAVIGSGPAGLATAQQLN
FT                   RAGHLVTVFERDEKPGGLLRYGIPDFKMEKHIIDRRLKVLEEEGIEFKCGINVGKDVDA
FT                   NDLKKEFDAIVLCGGATVRRKLPIKGSDLDGVVQAMDFLPQNNRRVDGIKKFDKEILAT
FT                   NKDVIVIGGGDTGSDCIGTSIRHGATSVSNFEIMPMATKERPEDQPWPFWPMRLKTSTS
FT                   HKEGAERFFSISTKEFVGDKDGRLKGLITSEVEWIKQPGQRPILKEIEGSEKEWKCELA
FT                   LLAMGFTGSEMTIAEQLGLEADTRTNIKASEKDYMSNVPGVFVAGDQRRGQSLIVWAIS
FT                   EGRQAAHHVDSYLMGESTLPLKGEGDLPRI"
     MGKTTGFLEF DRKVEGYTSV EKRVKHYKEF TVPMKAKELK DQGARCMDCG IPFCHSGCPL        60
     GNLIPDFNDA VYRGKWEKAT KILHATNNFP EFTGRLCPAP CEEACVLGIN EDPVTIENIE       120
     KNIVETAFKN GWITASSPAN RTGKTVAVIG SGPAGLATAQ QLNRAGHLVT VFERDEKPGG       180
     LLRYGIPDFK MEKHIIDRRL KVLEEEGIEF KCGINVGKDV DANDLKKEFD AIVLCGGATV       240
     RRKLPIKGSD LDGVVQAMDF LPQNNRRVDG IKKFDKEILA TNKDVIVIGG GDTGSDCIGT       300
     SIRHGATSVS NFEIMPMATK ERPEDQPWPF WPMRLKTSTS HKEGAERFFS ISTKEFVGDK       360
     DGRLKGLITS EVEWIKQPGQ RPILKEIEGS EKEWKCELAL LAMGFTGSEM TIAEQLGLEA       420
     DTRTNIKASE KDYMSNVPGV FVAGDQRRGQ SLIVWAISEG RQAAHHVDSY LMGESTLPLK       480
     GEGDLPRI                                                                488
//

If you have problems or comments...

PBIL Back to PBIL home page