(data stored in ACNUC7421 zone)

EMBL: CP002157.PE270

CP002157.PE270       Location/Qualifiers
FT   CDS             312240..312584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00020"
FT                   /product="50S ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00020"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99593"
FT                   /db_xref="GOA:A4AWS6"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWS6"
FT                   /protein_id="EAQ99593.1"
FT                   /translation="MPRSVNAVASRARRKKVMKQAKGYFGRRKNVWTVAKNAVEKAMLY
FT                   AYRDRRNKKRTFRALWITRINAGARLHGMSYSQFMGKVKANNIELNRKVLADLAMNHPD
FT                   AFKAIVDKVK"
     MPRSVNAVAS RARRKKVMKQ AKGYFGRRKN VWTVAKNAVE KAMLYAYRDR RNKKRTFRAL        60
     WITRINAGAR LHGMSYSQFM GKVKANNIEL NRKVLADLAM NHPDAFKAIV DKVK             114
//

If you have problems or comments...

PBIL Back to PBIL home page