(data stored in ACNUC7421 zone)

EMBL: CP002157.PE276

CP002157.PE276       Location/Qualifiers
FT   CDS             complement(317315..318268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00050"
FT                   /product="Acetyl-CoA carboxylase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00050"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99599"
FT                   /db_xref="GOA:A4AWT2"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWT2"
FT                   /protein_id="EAQ99599.1"
FT                   /translation="MEYLDFELPIKELEDQLDKCMIIGEESDVDVSETCKQIEKKLTET
FT                   RKDIYKNLTAWQRVQLSRHPNRPYTLDYINAICGDTFLELHGDRNVKDDKAMIGGLGKI
FT                   GDQSYMFIGQQKGYNTKTRQYRNFGMANPEGYRKALRLMKSAEKFGIPVICLIDTPGAY
FT                   PGIEAEERGQGEAIARNILEMTRLKVPIIVTIIGEGASGGALGIGVGDRVLMLENTWYS
FT                   VISPESCSSILWRSWEYKEQAADSLKLTAPDMKKLKLIDEIVREPAGGAHSNRDKTFEI
FT                   VKNKITAHYQELEKLSPKELVKLRMEKYANMGVFNG"
     MEYLDFELPI KELEDQLDKC MIIGEESDVD VSETCKQIEK KLTETRKDIY KNLTAWQRVQ        60
     LSRHPNRPYT LDYINAICGD TFLELHGDRN VKDDKAMIGG LGKIGDQSYM FIGQQKGYNT       120
     KTRQYRNFGM ANPEGYRKAL RLMKSAEKFG IPVICLIDTP GAYPGIEAEE RGQGEAIARN       180
     ILEMTRLKVP IIVTIIGEGA SGGALGIGVG DRVLMLENTW YSVISPESCS SILWRSWEYK       240
     EQAADSLKLT APDMKKLKLI DEIVREPAGG AHSNRDKTFE IVKNKITAHY QELEKLSPKE       300
     LVKLRMEKYA NMGVFNG                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page