(data stored in ACNUC7421 zone)

EMBL: CP002157.PE283

CP002157.PE283       Location/Qualifiers
FT   CDS             323925..326366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00085"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99606"
FT                   /db_xref="GOA:A4AWT9"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWT9"
FT                   /protein_id="EAQ99606.1"
FT                   /translation="MKKASFYQYSIKTQVLFNFLFIILFTLFSSFSNRNNDYYSNEKIY
FT                   IQFDKPNYYAGEDIWFKTYLLDAATHTPKTWSKVTYVELINPRNEIIETKTIKITDGGG
FT                   EGNFELSPDLISGEYTVRAYTNYMRNFDSAYFFRKKVYIKALKSDGTINKVPDANIVDK
FT                   AKPDIQFFPEGGYLVNGFLNRVGFKAVGVNGEGIAIEGTITDNASKEILELKTSKFGMG
FT                   VFEFIPKPDSSYKLNIVHEGVKLIYDLPIGIGHGTVMQVTEHDKDFRITLQSSLNNGLK
FT                   NFSLLGTQREGAVIRVKLKGAKSKSVIKVPKRILEQGIVQFTLFDNNKKPISERLSFYE
FT                   TDKASVNVSIKPSKKEYGKRELVKLEIHIDSIIQEKVQPNMSIAVTDMSAIEPDPFGLG
FT                   IKSQLLLKSELKGNIEKPGYYFNSDDPDRKRNLDILMMTQGWRKFITNDTLNDPSKPIF
FT                   FAETGISLSGQIKNFYNHNKSAIAEVSLTYDNSKELVHEVMLTDNNGQFAFNNLNFLDT
FT                   TSVIIQAKKIKNTEQRKRAKNPIMNFHIEMDSFVAPEITLKQKQRPEGFSRGPKNIATA
FT                   YLESLYQMPKGTIELDEVVLEEVITDRNSQYKKKRSLSLYKEPSHTIDFKDIKGLPYDN
FT                   WLIGLVGRIPGYSASGTLRGNISLGNSLPLYLLDGMPVEDVDDIAFLDIDFIDIVKGPR
FT                   AAIYGLRAGGGVIAIYTKDGSEKPNTAEDYKKRGIVSFEHPGYQAKKFYEPVYKTQKKE
FT                   DTKSDYRSTIYWNPTIRLDEQNKANISFYTSDVTSPYQIVLEGISLDGEIISAVTYLNL
FT                   P"
     MKKASFYQYS IKTQVLFNFL FIILFTLFSS FSNRNNDYYS NEKIYIQFDK PNYYAGEDIW        60
     FKTYLLDAAT HTPKTWSKVT YVELINPRNE IIETKTIKIT DGGGEGNFEL SPDLISGEYT       120
     VRAYTNYMRN FDSAYFFRKK VYIKALKSDG TINKVPDANI VDKAKPDIQF FPEGGYLVNG       180
     FLNRVGFKAV GVNGEGIAIE GTITDNASKE ILELKTSKFG MGVFEFIPKP DSSYKLNIVH       240
     EGVKLIYDLP IGIGHGTVMQ VTEHDKDFRI TLQSSLNNGL KNFSLLGTQR EGAVIRVKLK       300
     GAKSKSVIKV PKRILEQGIV QFTLFDNNKK PISERLSFYE TDKASVNVSI KPSKKEYGKR       360
     ELVKLEIHID SIIQEKVQPN MSIAVTDMSA IEPDPFGLGI KSQLLLKSEL KGNIEKPGYY       420
     FNSDDPDRKR NLDILMMTQG WRKFITNDTL NDPSKPIFFA ETGISLSGQI KNFYNHNKSA       480
     IAEVSLTYDN SKELVHEVML TDNNGQFAFN NLNFLDTTSV IIQAKKIKNT EQRKRAKNPI       540
     MNFHIEMDSF VAPEITLKQK QRPEGFSRGP KNIATAYLES LYQMPKGTIE LDEVVLEEVI       600
     TDRNSQYKKK RSLSLYKEPS HTIDFKDIKG LPYDNWLIGL VGRIPGYSAS GTLRGNISLG       660
     NSLPLYLLDG MPVEDVDDIA FLDIDFIDIV KGPRAAIYGL RAGGGVIAIY TKDGSEKPNT       720
     AEDYKKRGIV SFEHPGYQAK KFYEPVYKTQ KKEDTKSDYR STIYWNPTIR LDEQNKANIS       780
     FYTSDVTSPY QIVLEGISLD GEIISAVTYL NLP                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page