(data stored in ACNUC7421 zone)

EMBL: CP002157.PE285

CP002157.PE285       Location/Qualifiers
FT   CDS             complement(326947..327438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00095"
FT                   /product="putative shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00095"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99608"
FT                   /db_xref="GOA:A4AWU1"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWU1"
FT                   /protein_id="EAQ99608.1"
FT                   /translation="MGSGKSTIGRLLANELNYDFIDLDDFIESNEQMKIPMIFESKGEI
FT                   YFRKKEFEYLKQILANKDNFILATGGGTPCYGENMSAMLEATSNVFYLKVSISRLIDRL
FT                   VLEKEHRPLITNIPDEELPEFIGKHLFERSYFYSKANNSIFCDEKKADEIRSEIEGLLV
FT                   "
     MGSGKSTIGR LLANELNYDF IDLDDFIESN EQMKIPMIFE SKGEIYFRKK EFEYLKQILA        60
     NKDNFILATG GGTPCYGENM SAMLEATSNV FYLKVSISRL IDRLVLEKEH RPLITNIPDE       120
     ELPEFIGKHL FERSYFYSKA NNSIFCDEKK ADEIRSEIEG LLV                         163
//

If you have problems or comments...

PBIL Back to PBIL home page