(data stored in ACNUC7421 zone)

EMBL: CP002157.PE287

CP002157.PE287       Location/Qualifiers
FT   CDS             330121..331050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00105"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99610"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR027849"
FT                   /db_xref="InterPro:IPR033402"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWU3"
FT                   /protein_id="EAQ99610.1"
FT                   /translation="MQITGTFLDEISHDIPHQNWGEKEWDIDFQHMKKMGIDTVILIRS
FT                   GYRKFLTYPSKYLVNMQGCFKPPVDLLKLYLELSEKYGMMFYFGTYDSGKYWDTGDMRH
FT                   EIDLNLQVIEEVYKNYGHFKSFGGWYMSLELSRKTKGAVESIAKLGNHCKAISNGLPVL
FT                   ISPWMDGKKAVLARTGQITKESFITFKEHEAEWDEIFDGIKNSIDIVAFQDGHVDFNEL
FT                   EEYLTINKSLADKYALQSWTNSESFDRDMPIKFLPIKWEKLLLKLEAAKRAGCEKAITF
FT                   EFSHFMSPQSAYLQAGHLYNRYMEHFQK"
     MQITGTFLDE ISHDIPHQNW GEKEWDIDFQ HMKKMGIDTV ILIRSGYRKF LTYPSKYLVN        60
     MQGCFKPPVD LLKLYLELSE KYGMMFYFGT YDSGKYWDTG DMRHEIDLNL QVIEEVYKNY       120
     GHFKSFGGWY MSLELSRKTK GAVESIAKLG NHCKAISNGL PVLISPWMDG KKAVLARTGQ       180
     ITKESFITFK EHEAEWDEIF DGIKNSIDIV AFQDGHVDFN ELEEYLTINK SLADKYALQS       240
     WTNSESFDRD MPIKFLPIKW EKLLLKLEAA KRAGCEKAIT FEFSHFMSPQ SAYLQAGHLY       300
     NRYMEHFQK                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page