(data stored in ACNUC7421 zone)

EMBL: CP002157.PE288

CP002157.PE288       Location/Qualifiers
FT   CDS             331052..332923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00110"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99611"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWU4"
FT                   /protein_id="EAQ99611.1"
FT                   /translation="MMINQFKLLFIVFLSLPLAHAQNQVDVLIIGGGAGGTSAGIQAAR
FT                   MGINVQIIEATPWLGGMLTSAGVSAIDGNHEMPSGIWGEFQQKLRDYYGGEKALATGWV
FT                   SHTLFEPSIGNRLLKEMADEPNLEIAFNAIYRDVQKDGEGWLVTYKQKEKWYTTKTKIL
FT                   IDATEIGELLPLVEADFRLGMDSREDTGEKEAPETANTIVQDLTYVLILEDVSKDSNLR
FT                   RNKGLVKKPKNYNPEAYECACKRENGEMFGGVSNCRQMLDYGKLPNDKYMINWPNCGND
FT                   FYLNWPELTTSQRKEKLNEAKSFTQGFIYYIQNELGFKNLRVAEEFPTKDNLPMIPYDR
FT                   EARRVKGKTFLIVDHLERPYDFNLYKTGIAVGDYPIDHHHDKNPNAPRIDFINIKVPSY
FT                   NIPLGSLIPNKTENFIVAEKNISVSNIVNGTTRLQPVILGIGQAAGALAATAIKENEIP
FT                   SEISIRKVQNALLESNAYLMPFIDVKKEDSAFEAMQRIGATGVLKGYGIPYKWANQTWF
FT                   YPDQVVSEYELKNGLLPYYPELELIHASGAPATPNFINSLVEKANSDSSLMLIKGDWKS
FT                   WGIDQDYSDSISLNRRSVSILIDKILNPFVMEVNFYGNLKQDKLKKN"
     MMINQFKLLF IVFLSLPLAH AQNQVDVLII GGGAGGTSAG IQAARMGINV QIIEATPWLG        60
     GMLTSAGVSA IDGNHEMPSG IWGEFQQKLR DYYGGEKALA TGWVSHTLFE PSIGNRLLKE       120
     MADEPNLEIA FNAIYRDVQK DGEGWLVTYK QKEKWYTTKT KILIDATEIG ELLPLVEADF       180
     RLGMDSREDT GEKEAPETAN TIVQDLTYVL ILEDVSKDSN LRRNKGLVKK PKNYNPEAYE       240
     CACKRENGEM FGGVSNCRQM LDYGKLPNDK YMINWPNCGN DFYLNWPELT TSQRKEKLNE       300
     AKSFTQGFIY YIQNELGFKN LRVAEEFPTK DNLPMIPYDR EARRVKGKTF LIVDHLERPY       360
     DFNLYKTGIA VGDYPIDHHH DKNPNAPRID FINIKVPSYN IPLGSLIPNK TENFIVAEKN       420
     ISVSNIVNGT TRLQPVILGI GQAAGALAAT AIKENEIPSE ISIRKVQNAL LESNAYLMPF       480
     IDVKKEDSAF EAMQRIGATG VLKGYGIPYK WANQTWFYPD QVVSEYELKN GLLPYYPELE       540
     LIHASGAPAT PNFINSLVEK ANSDSSLMLI KGDWKSWGID QDYSDSISLN RRSVSILIDK       600
     ILNPFVMEVN FYGNLKQDKL KKN                                               623
//

If you have problems or comments...

PBIL Back to PBIL home page