(data stored in ACNUC7421 zone)

EMBL: CP002157.PE291

CP002157.PE291       Location/Qualifiers
FT   CDS             335484..335900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00125"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99614"
FT                   /db_xref="InterPro:IPR009783"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWU7"
FT                   /protein_id="EAQ99614.1"
FT                   /translation="MKKITPPFNNESAAAKVQAAEDAWNSRDAKKVSMAYTLDSQWRNR
FT                   DKFFVGRKAIVEFLKDKWLNERHYILRKYLWSYTDNRISVRFEYEWQDANSGQWKRTHG
FT                   NEHWEFDKDGLMQVRDMSANDIDIIESDRKFINH"
     MKKITPPFNN ESAAAKVQAA EDAWNSRDAK KVSMAYTLDS QWRNRDKFFV GRKAIVEFLK        60
     DKWLNERHYI LRKYLWSYTD NRISVRFEYE WQDANSGQWK RTHGNEHWEF DKDGLMQVRD       120
     MSANDIDIIE SDRKFINH                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page