(data stored in ACNUC7421 zone)

EMBL: CP002157.PE292

CP002157.PE292       Location/Qualifiers
FT   CDS             336016..336570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00130"
FT                   /product="probable Mip protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00130"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99615"
FT                   /db_xref="GOA:A4AWU8"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWU8"
FT                   /protein_id="EAQ99615.1"
FT                   /translation="MNTLNPLKEEEANENSKAIFSNLKSKIGMVPNLYATMGVSDKLLG
FT                   GYLTFVDTLKSGEFSNKEYEAIALATSQANNCAYCLSAHTAIGKMNGFSEEETLELRSN
FT                   SIADNKLNVLVTLVSEFIESKGHPTENTTSRFFEVGYTKAAFAELIAAISMTTITNYVY
FT                   HNGGFEIDFPKAQGIENLQTV"
     MNTLNPLKEE EANENSKAIF SNLKSKIGMV PNLYATMGVS DKLLGGYLTF VDTLKSGEFS        60
     NKEYEAIALA TSQANNCAYC LSAHTAIGKM NGFSEEETLE LRSNSIADNK LNVLVTLVSE       120
     FIESKGHPTE NTTSRFFEVG YTKAAFAELI AAISMTTITN YVYHNGGFEI DFPKAQGIEN       180
     LQTV                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page