(data stored in ACNUC7421 zone)

EMBL: CP002157.PE294

CP002157.PE294       Location/Qualifiers
FT   CDS             337590..337763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00140"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99617"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWV0"
FT                   /protein_id="EAQ99617.1"
FT                   /translation="MRSIKKSVRGLPKTSNHPLKIENNYEIHQIKWFPFRTDLSPFKTD
FT                   LPYSLEIVLHMI"
     MRSIKKSVRG LPKTSNHPLK IENNYEIHQI KWFPFRTDLS PFKTDLPYSL EIVLHMI           57
//

If you have problems or comments...

PBIL Back to PBIL home page