(data stored in ACNUC7421 zone)

EMBL: CP002157.PE295

CP002157.PE295       Location/Qualifiers
FT   CDS             337848..337985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00145"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99618"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWV1"
FT                   /protein_id="EAQ99618.1"
FT                   /translation="MKTIKSNLIALSTIRMQEGSYGKIKRTYPKPNFEMGFFEALSITK
FT                   "
     MKTIKSNLIA LSTIRMQEGS YGKIKRTYPK PNFEMGFFEA LSITK                        45
//

If you have problems or comments...

PBIL Back to PBIL home page